Name :
ERGIC3 (Human) Recombinant Protein
Biological Activity :
Human ERGIC3 (NP_057050, 47 a.a. – 341 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Tag :
Protein Accession No. :
Q9Y282
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=51614
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSF
Molecular Weight :
36.1
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. SDS-PAGE analysis of ERGIC3 (Human) Recombinant Protein
Storage Buffer :
In PBS, pH 7.4 (1 mM DTT, 10% glycerol).
Applications :
SDS-PAGE，
Gene Name :
ERGIC3
Gene Alias :
C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84, dJ477O4.2
Gene Description :
ERGIC and golgi 3
Gene Summary :
Other Designations :
OTTHUMP00000030758|OTTHUMP00000030760|endoplasmic reticulum-localized protein ERp43|serologically defined breast cancer antigen 84
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-5 Recombinant Proteins
MMP-2 web
Popular categories:
FGL-1
Protein Tyrosine Kinase 7