Sun. Apr 19th, 2026

Name :
Tnf (Mouse) Recombinant Protein

Biological Activity :
Mouse Tnf (P06804, 8 a.a. – 235 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P06804

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=21926

Amino Acid Sequence :
RDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Weight :
18

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Viruses

Interspecies Antigen Sequence :

Preparation Method :
Baculovirus expression system

Purification :

Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

Storage Buffer :
In Phosphate-Buffer Saline pH 7.4

Applications :
Functional Study, SDS-PAGE,

Gene Name :
Tnf

Gene Alias :
DIF, MGC151434, TNF-alpha, TNFSF2, TNFalpha, Tnfa, Tnfsf1a

Gene Description :
tumor necrosis factor

Gene Summary :

Other Designations :
TNF alpha|tumor necrosis factor alpha|tumor necrosis factor-alpha

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Integrin Recombinant Proteins
LIF Proteinmedchemexpress
Popular categories:
Animal-free Recombinant Proteins
BMP-6