Wed. Jun 17th, 2026

Name :
TNFRSF18 (Human) Recombinant Protein

Biological Activity :
Human TNFRSF18 (Q9UNG2, 81 a.a. – 199 a.a) partial-length recombinant protein with T7-tag at N-terminal expressed in Escherichia coli.

Tag :

Protein Accession No. :
Q9UNG2

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=8995

Amino Acid Sequence :
MASMTGGQQMGRGSHMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS.

Molecular Weight :
15

Storage and Stability :
Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
20mM Tris-HCl buffer (pH 8.0), 10% glycerol and 0.4M Urea.

Applications :
SDS-PAGE,

Gene Name :
TNFSF18

Gene Alias :
AITRL, GITRL, MGC138237, TL6, hGITRL

Gene Description :
tumor necrosis factor (ligand) superfamily, member 18

Gene Summary :
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. [provided by RefSeq

Other Designations :
AITR ligand|GITR ligand|glucocorticoid-induced TNFR-related protein ligand

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF-9 ProteinMedChemExpress
IL-7 MedChemExpress
Popular categories:
MIP-3 beta/CCL19
UCH-L3