Wed. Jan 14th, 2026

Name :
IL12RB1 (Human) Recombinant Protein

Biological Activity :
Human IL12RB1 full-length ORF (AAH29121.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
AAH29121.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3594

Amino Acid Sequence :
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF

Molecular Weight :
42.4

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (47); Rat (47)

Preparation Method :
in vitro wheat germ expression system with proprietary liposome technology

Purification :
None

Quality Control Testing :

Storage Buffer :
25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Applications :
Antibody Production,

Gene Name :
IL12RB1

Gene Alias :
CD212, IL-12R-BETA1, IL12RB, MGC34454

Gene Description :
interleukin 12 receptor, beta 1

Gene Summary :
The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The lack of expression of this gene was found to result in the immunodeficiency of patients with severe mycobacterial and Salmonella infections. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq

Other Designations :
IL-12 receptor beta component|interleukin-12 receptor beta-1 chain

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-3 ProteinAccession
Carbonic Anhydrase 1 ProteinStorage & Stability
Popular categories:
FGF-20
IgA