Recombinant Human MOSPD2, N-His
Name : Recombinant Human MOSPD2, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q8NHP6
Synonyms :
Recombinant Human MOSPD2, N-His
Amino Acid Sequence :
Molecular Weight :
55.11 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human MOSPD2 (Met1-Asp469) was fused with the N-terminal His Tag.
Formulation :
Supplied as solution form in PBS pH 7.4.
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
7497-07-6 IUPAC Name 58-05-9 Biological Activity PMID:29999705 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Escherichia coli Peptidyl-tRNA hydrolase(pth)
Product Name :
Recombinant Escherichia coli Peptidyl-tRNA hydrolase(pth)
Brief Description :
Recombinant Protein
Accession No. :
P0A7D1
Calculated MW :
25.1 kDa
Target Sequence :
MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P0A7D1
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
RBPMS Antibody In stock Inotuzumab CD22 PMID:34904330 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human ADAM28, N-His
Name : Recombinant Human ADAM28, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q9UKQ2
Synonyms :
Recombinant Human ADAM28, N-His
Amino Acid Sequence :
Molecular Weight :
30.10 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human ADAM28(Glu525-Lys774) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
5786-21-0 medchemexpress 1115-70-4 IUPAC Name PMID:29489164 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Rhesus Macaque Granulocyte-macrophage colony-stimulating factor protein(GM-CSF)
Product Name :
Recombinant Rhesus Macaque Granulocyte-macrophage colony-stimulating factor protein(GM-CSF)
Brief Description :
Recombinant Protein
Accession No. :
Q9GL44
Calculated MW :
14.4 kDa
Target Sequence :
APARSPSPGT QPWEHVNAIQ EARRLLNLSR DTAAEMNKTV EVVSEMFDLQ EPSCLQTRLE LYKQGLQGSL TKLKGPLTMM ASHYKQHCPP TPETSCATQI ITFQSFKENL KDFLLVIPFD CWEPVQE
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q9GL44
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
G-418 disulfate (Standard) Epigenetics 2,4-Dinitrobenzenesulfonic acid sodium salt medchemexpress PMID:35145019 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human Dermokine-alpha/DMKN, N-His & N-SUMO
Name : Recombinant Human Dermokine-alpha/DMKN, N-His & N-SUMO
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q6E0U4
Synonyms :
Recombinant Human Dermokine-alpha/DMKN, N-His & N-SUMO
Amino Acid Sequence :
Molecular Weight :
19.56 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human Dermokine-alpha / DMKN(Trp27-Trp90) was fused with the N-His & N-SUMO Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
1190389-15-1 Biological Activity 50-35-1 custom synthesis PMID:25905374 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human Fibroblast growth factor 17 protein(FGF17)
Product Name :
Recombinant Human Fibroblast growth factor 17 protein(FGF17)
Brief Description :
Recombinant Protein
Accession No. :
O60258
Calculated MW :
22.6 kDa
Target Sequence :
M+TQGENHPSP NFNQYVRDQG AMTDQLSRRQ IREYQLYSRT SGKHVQVTGR RISATAEDGN KFAKLIVETD TFGSRVRIKG AESEKYICMN KRGKLIGKPS GKSKDCVFTE IVLENNYTAF QNARHEGWFM AFTRQGRPRQ ASRSRQNQRE AHFIKRLYQG QLPFPNHAEK QKQFEFVGSA PTRRTKRTRR PQPLT
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
O60258
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Cytokeratin 6 Antibody manufacturer Shh Antibody Purity & Documentation PMID:35070143 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human CD207, N-GST
Name : Recombinant Human CD207, N-GST
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q9UJ71
Synonyms :
Recombinant Human CD207, N-GST
Amino Acid Sequence :
Molecular Weight :
56.67 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human CD207(Pro65-Pro328) was fused with the N-GST Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
129298-91-5 MedChemExpress 701232-20-4 InChIKey PMID:30000048 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Helicobacter pylori (Campylobacter pylori) Cytotoxicity-associated immunodominant antigen
Product Name :
Recombinant Helicobacter pylori (Campylobacter pylori) Cytotoxicity-associated immunodominant antigen
Brief Description :
Recombinant Protein
Accession No. :
P55746
Calculated MW :
35.5 kDa
Target Sequence :
KNFNNNNNNGLKNGGEPIYAQVNKKKTGQVASPEEPIYAQVAKKVTKKIDQLNQAATSGFGGVGQAGFPLKRHDKVEDLSKVGRSVSPEPIYATIDDLGGSFPLKRHDKVDDLSKVGLSRNQELTQKIDNLSQAVSEAKAGFFGNLEQTIDKLKDFTKNNPVNLWAESAKKVPASLSAKLDNYATNSHTRINSNIQNGAINEKATGTERQKNPEWLKLVNDKIVAHNVGSVPLSEYDNIGFSQKNMKDYSDSFKFSTKLNNAVKDIKSGFTQFLANAFSTGYYSMARENAEHGIKNANTKGGFQKS
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P55746
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
SARS-CoV-2 S Protein RBD (HEK293)Biological Activity CD42A Antibody supplier PMID:35204569 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human MSRA, N-His
Name : Recombinant Human MSRA, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q9UJ68
Synonyms :
Recombinant Human MSRA, N-His
Amino Acid Sequence :
Molecular Weight :
25.55 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human MSRA(Ala27-Lys235) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
203787-91-1 custom synthesis 60857-08-1 Description PMID:30252361 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human UV excision repair protein RAD23 homolog A
Product Name :
Recombinant Human UV excision repair protein RAD23 homolog A
Brief Description :
Recombinant Protein
Accession No. :
P54725
Calculated MW :
41.6 kDa
Target Sequence :
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P54725
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Risperidone Cancer PDGFD Antibody MedChemExpress PMID:35026576 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com