Pancreatic prohormone

Product Name :
Pancreatic prohormone

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P01302

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:PPY

Uniprot :
P01302

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
LGALS1 Antibody Autophagy CD108 Antibody Protocol PMID:34929602 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Polycomb group RING finger protein 6

Product Name :
Polycomb group RING finger protein 6

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:Q5XI70

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:Pcgf6

Uniprot :
Q5XI70

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
SMPD1 Antibody Protocol Ticagrelor impurity 14 Protocol PMID:35223847 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Prostaglandin E synthase 2

Product Name :
Prostaglandin E synthase 2

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:Q9H7Z7

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:PTGES2

Uniprot :
Q9H7Z7

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Inolimomab Immunology/Inflammation Glutamate Receptor 1 Antibody Biological Activity PMID:35240498 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Mouse Follistatin-Like 1,FSTL1 (C-6His)

Product Name :
Recombinant Mouse Follistatin-Like 1,FSTL1 (C-6His)

Brief Description :

Accession No. :
Q62356

Calculated MW :
33.5kDa

Target Sequence :
EEEPRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSASPSASPVVCYQANRDELRRRLIQWLEAEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAINITTYADQENNKLLRSLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTEEEKTGYVQELQKHQGTAEKTKKVNTKEIVDHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
Q62356

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
cadherin Antibody Cancer 4-Methylthiazole Autophagy PMID:34289506 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Myelin proteolipid protein

Product Name :
Myelin proteolipid protein

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P23294

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:PLP1

Uniprot :
P23294

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
GRM3 Antibody Technical Information PARP16 Antibody MedChemExpress PMID:35012614 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

MOB kinase activator 1A

Product Name :
MOB kinase activator 1A

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:Q9H8S9

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:MOB1A

Uniprot :
Q9H8S9

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Triamcinolone site 15 PGDH Antibody site PMID:34920885 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Mouse Pulmonary Surfactant-associated Protein D,SP-D (C-6His)

Product Name :
Recombinant Mouse Pulmonary Surfactant-associated Protein D,SP-D (C-6His)

Brief Description :

Accession No. :
P50404

Calculated MW :
36.7kDa

Target Sequence :
AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEFVDHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
P50404

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
59-67-6 Description 59-92-7 manufacturer PMID:29489219 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Myosin-7

Product Name :
Myosin-7

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P49824

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:MYH7

Uniprot :
P49824

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
2-(Ethylamino)ethanol Formula PARP2 Antibody MedChemExpress PMID:34932434 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human BCHE

Product Name :
Recombinant Human BCHE

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:P06276Gene Accession:BC008396

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
P06276

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
1103522-45-7 manufacturer 85-61-0 Description PMID:29999884 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Mouse S100 Calcium Binding Protein B,S100B (C-6His)

Product Name :
Recombinant Mouse S100 Calcium Binding Protein B,S100B (C-6His)

Brief Description :

Accession No. :
P50114

Calculated MW :
11.8kDa

Target Sequence :
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHELEHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
P50114

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Garadacimab Purity NPM3 Antibody Autophagy PMID:35125374 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Pancreatic prohormone

Polycomb group RING finger protein 6

Prostaglandin E synthase 2

Recombinant Mouse Follistatin-Like 1,FSTL1 (C-6His)

Myelin proteolipid protein

MOB kinase activator 1A

Recombinant Mouse Pulmonary Surfactant-associated Protein D,SP-D (C-6His)

Myosin-7

Recombinant Human BCHE

Recombinant Mouse S100 Calcium Binding Protein B,S100B (C-6His)

You Missed

Pancreatic prohormone

Polycomb group RING finger protein 6

Prostaglandin E synthase 2

Recombinant Mouse Follistatin-Like 1,FSTL1 (C-6His)